Skip to main content

Table 1 N-terminal sequence of the main peaks eluted from the chromatographic steps. Assignment of the peaks to protein families by BLAST against a Tityus venom database

From: Partial purification and functional characterization of Ts19 Frag-I, a novel toxin from Tityus serrulatus scorpion venom

Peak N-terminal sequence Protein family (Uniprot ID)
6 KDKMKAGWERLTSQSEYACP… Ts19 Frag-II (P86822)
KIKEKIIEAKDKMKAGWERL… Ts19 Frag-I (P86822)
7 KKDGYPVEYDNCAYICWNYDNAY… Ts3 (P01496)
KDKMKAGWERLTSQSEYACPAID… Ts19 Frag-II (P86822)
8 KIKEKIIEAKDKMKAGWERLTSQSEYACPAIDKFCEDHCAAKKAVGKCDDFKCNCIK Ts19 Frag-I (P86822)
KEGYAMDHEGCKFSCFIRPAGFCDGYCKTHLKASSGYCAWPACYCYGVPD… Ts2 (P68410)
9 KIKEKIIEAKDKMKAGWERLTSQSEYA… Ts19 Frag-I (P86822)
KKDGYPVEYDNCAYICWNYDNAYCDKL… Ts3 (P01496)
KEGYAMDHEGCKFSCFIRPAGFCDGYC… Ts2 (P68410)
10 GREGYPADSKGCKITCFLTAAGYCNTECTL… Ts4 (P45669)
11 GREGYPADSKGCKITCFLTA… Ts4 (P45669)
12 GREGY… Ts4 (P45669)
13 KLVALIPNDQLRSILKAVVHKVAKTQFGCPAYEGYCNDHCNDIERKDG… Ts8 (P69940)
GLREKHVQKLVALIPNDQLRSILKAVVHKVAKTQFGCPAYEGYCNDHC… Ts8 propeptide (P69940)
GREGYPADSKG… Ts4 (P45669)
9.2 KIKEKIIEAK… Ts19 Frag-I (P86822)
KEGYAMDHEG… Ts2 (P68410)
9.3 KIKEKIIEAKDKMKA… Ts19 Frag-I (P86822)
KEGYAMDHEGCKFSC… Ts2 (P68410)
  1. …, the primary sequence was not completely determined