Skip to main content

Table 1 Tryptic peptides identified through MS/MS analysis

From: Purification and enzymatic characterization of a novel metalloprotease from Lachesis muta rhombeata snake venom

Scan time Fragmentation mode MS/MS derived sequence z Observed m/z Calculated m/z Mass deviation (ppm) Score
19.56 HCD TFGEWRER 2 540.7645 540.7647 −0.37 623.7
5.86 HCD VLLNR 2 307.7031 307.7028 0.97 309.1
28.43 HCD SNQDLINVQSAAADTLK 2 894.4609 894.4603 −2.35 415.4
35.27 HCD DYYEMFLTK 2 605.2787 605.2785 0.33 288.7
14.12 HCD YNGNLNTIR 2 532.7779 532.7778 0.19 476.3
10.00 HCD NSVGIVQDHSPK 2 640.8334 640.8333 0.16 716.8
28.43 HCD TRVHEIVNTLNGFYR 2 909.9846 909.9841 0.55 730.8
13.42 HCD KPQCILNKP 2 549.3105 549.3104 0.19 431.7
36.74 ETD YIELVVVADHGMFTK 3 574.6362 574.6359 0.52 722.1
28.49 ETD VHEIVNTLNGFYR 3 521.2755 521.2756 −0.19 926.1
3253 ETD ISHDNAQLLTAIDLADNTIGIAYTGGMCYPK 5 671.3300 671.3296 0.60 1359.6
9.63 ETD NSVGIVQDHSPK 3 427.5580 427.5580 0 707.5
37.16 ETD HDENHCHCSASFCIMPPSISEGPSYEFSDCSK 5 755.3034 755.3031 0.40 1248.5
32.92 ETD TLLIAVTMAHELGHNLGMK 4 517.0287 517.0288 −0.19 1093.1
9.72 ETD RKPQCILNKP 3 418.5764 418.5764 0 545.7
19.86 ETD KPQCILNKPX 3 404.2375 404.2374 0.25 550.7
18.00 ETD RKPQCILNKPX 3 456.2714 456.2711 0.66 383.5
  1. Cys residues are carbamidomethylated and amino acid residues different from the database are shown in bold. X represents Leu/Ile. M is oxidized Met