Skip to main content

Table 4 N-terminal sequences from the poison fractions by Edman’s degradation technique

From: Deep sequencing analysis of toad Rhinella schneideri skin glands and partial biochemical characterization of its cutaneous secretion

Fraction Protein sequence Protein family
CS1 RWEECEDCDDDQDDQQQQQCAKDDDDE---Q-QQD Lectin
CS24a GLLEFNKMIKFETRKNAIPFYAFYGCYCGWGGRRRPK PLA2
CS24b -TPFYKGAAGQQVPQDIVNYYAFGGCQK—EP-PMRY-EY-VNAGGDQ-------D Galectin
CS25 -L-EFNKMIKFETRKNAIPFYAFY PLA2
CS26 -L-EFNKMIKFETRKNAIPFYAFYGCYCGWGGRRRPKDA PLA2